Cervidor Deer Tail 800mg 60 Capsules

Excl. GST

$69.57

Tax included. Shipping calculated at checkout.
SKU: 1865-CDT800N/A
Out of stock
Parcels normally take 1-3 days to arrive within New Zealand or 3-14 days to arrive in other destinations, depending on where you are located. hoursminutes

american expressjcbapple paymasterpaypalvisaalipaywechatpay

Cervidor is an expert and a global reference standard for deer products.  We harness the strength and efficacy of free-range New Zealand Red Deer through a vertically integrated supply chain from the farm to finished product. 100% natural and pure active ingredients guaranteed.

Deer Tails containOriental medical beliefs consider Deer Tails beneficial in reducing stress and of high value towards curing Joint, Kidney and Nervous disorders.

Grown and Made in New Zealand

60 x 800mg Capsules

How it works: Cervidor Deer Tail contains Sulphur, Calcium and Phosphorus, have a high level of Lipid and are low in protein and ash levels. Oriental medicine beliefs consider Deer Tail beneficial for:

  • enhancing kidney function
  • reducing stress levels
  • balancing hormones
  • managing pain and tonifying the yang.

Ingredients: Each capsule includes 200mg of Deer Tail Powder, equivalent to 800mg of fresh Deer Tail.  No other ingredients, additives, fillers or excipients.

Dosage:  Adults-take 1-2 capsules daily or as professionally directed. Always check with your doctor first if you are taking prescribed medicine.

Storage Store in a cool dry place away from direct sunshine. Do not use if cap seal is missing or broken.

Always check with your doctor first if you are taking prescribed medicine.

Sunday,Monday,Tuesday,Wednesday,Thursday,Friday,Saturday
January,February,March,April,May,June,July,August,September,October,November,December
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return To Shop

Add Order Note Edit Order Note
Estimate Shipping

Estimate Shipping

Cervidor Deer Tail 800mg 60 Capsules

$69.57