Aotea WellnessAotea WellnessAotea Wellness

Cervidor Deer Blood 2,500mg 60 Capsules

Excl. GST

$52.09

Tax included. Shipping calculated at checkout.
SKU: 1865-CDB2500N/A
Out of stock
*Due to increased holiday demand, we kindly ask for your understanding as shipping and fulfillment times may be extended.*
Parcels normally take 1-3 days to arrive within New Zealand or 3-14 days to arrive in other destinations, depending on where you are located. hoursminutes

american expressjcbapple paymasterpaypalvisaalipaywechatpay

Cervidor is an expert and a global reference standard for deer products. We harness the strength and efficacy of free-range New Zealand Red Deer through a vertically integrated supply chain from the farm to finished product. 100% natural and pure active ingredients guaranteed.

Grown and Made in New Zealand

60 x 2500mg Capsules

How it works: Cervidor Deer Blood is high in protein and elemental iron. Oriental medicine beliefs consider Deer Blood beneficial for:

  • supporting cardiac function
  • facilitating the supply of oxygen to cells
  • improving Immune System functioning
  • providing Vitality and Anti-ageing properties

Ingredients: Each capsule includes 500mg of Deer Blood Powder, equivalent to 2500mg of fresh Deer Blood. No other ingredients, additives, fillers or excipients.

Dosage: Adults-take 1-2 capsules daily or as professionally directed. Always check with your doctor first if you are taking prescribed medicine.

Storage:Store in a cool dry place away from direct sunshine. Do not use if cap seal is missing or broken.

Always check with your doctor first if you are taking prescribed medicine.

Sunday,Monday,Tuesday,Wednesday,Thursday,Friday,Saturday
January,February,March,April,May,June,July,August,September,October,November,December
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return To Shop

Add Order Note Edit Order Note
Estimate Shipping

Estimate Shipping

Cervidor Deer Blood 2,500mg 60 Capsules

$52.09