Wild Ferns Lanolin Moisturising Facial Lotion with Green Tea and Manuka Honey (100ml)

Excl. GST

$16.43 $12.33

Shipping calculated at checkout.
SKU: 169-LAMFLN/A
Out of stock
Parcels normally take 1-3 days to arrive within New Zealand or 3-14 days to arrive in other destinations, depending on where you are located. hoursminutes

american expressjcbapple paymasterpaypalvisaalipaywechatpay

Wild Ferns - Lanolin Moisturising Facial Lotion with Green Tea and Manuka Honey 100ml

Help nourish and enrich your skin with hydrating and nourishing Lanolin combined with Manuka Honey - renowned for its restorative and healing effects. Green Tea, rich in antioxidants, works to shield the skin against everyday environmental damage. This is a moisturiser that calms the skin and gently restores a more youthful glow.

With the difference between a face lotion and a creme being its oil to water ratio, a lotion has less oil so is much lighter on the skin. It absorbs quickly and leaves very little residue. This is a fantastic option during the warmer more humid months or when your skin type has changed due to the climate.

Other Beneficial Ingredients;

  • Collagen
  • Evening Primrose Oil
  • Ginger Root Extract
  • Sage Leaf Extract
  • Sesame Seed Oil
  • Borage Seed Oil
  • Meadowfoam Seed Oil

Directions: After cleansing apply a small amount of lotion and gently smooth in an upward direction onto the face and neck. May be used morning or night.

Complementary Product

  • Facial Cleanser with Apple and Olive Leaf Extracts
  • Foaming Facial Wash with Propolis and Sweet Orange Oil
  • Toner with Propolis and Comfrey
  • Facial Scrub with Cucumber and Avocado
  • Night Crème (Combination to Oily) with Collagen, Placenta and Propolis

97% Natural

  • Paraben Free
  • No Mineral Oil
  • No tested on Animals

Made in New Zealand
100ml/3.38oz

Sunday,Monday,Tuesday,Wednesday,Thursday,Friday,Saturday
January,February,March,April,May,June,July,August,September,October,November,December
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return To Shop

Add Order Note Edit Order Note
Estimate Shipping

Estimate Shipping

Wild Ferns Lanolin Moisturising Facial Lotion with Green Tea and Manuka Honey (100ml)

$16.43 $12.33