Aotea WellnessAotea WellnessAotea Wellness

Royal Nectar Shield Mask

Excl. GST

$6.00

Shipping calculated at checkout.
SKU: 1773-16159N/A
Out of stock
*Due to increased holiday demand, we kindly ask for your understanding as shipping and fulfillment times may be extended.*
Parcels normally take 1-3 business days to arrive within New Zealand or 7-14 business days to arrive in other destinations, depending on where you are located. hoursminutes

american expressjcbapple paymasterpaypalvisaalipaywechatpay

Product Description

To restore and revitalise radiance

Royal Nectar Shield Mask contains our famous Nectar Ease™, a blend of Bee Venom and Active Manuka Honey, to stimulate the skin providing an immediate anti-aging effect. Bee Venom tightens and plumps while the active Manuka Honey nourishes and protects the skin.

Key Ingredients

Bee Venom and Manuka Honey (Nectar Ease™) Bee Venom helps restore and revitalise radiance, while Manuka Honey is known to heal, nourish & protect the skin.

Hyaluronic Acid helps reduce the visibility of fine lines and wrinkles, retaining moisture to the skin, creating a plumping effect.

Usage

Directions: (1) Cleanse: gently rinse your skin with water, (2) Apply: place the shield mask on your face, (3) Relax: leave up to 10-20 min, then remove. Massage any remaining essence into your skin.

 

Full Ingredient Listing

Aqua, Glycerin, Butylene Glycol, Leptospermum Scoparium Mel (Manuka Honey Nectar Ease), Bee Venom, Terminalia Ferdinandiana Fruit Extract (and) Podocarpus Elatus Fruit Extract (and) Pleiogynium Timorense Fruit (Plum) Extract, Xanthan Gum, Phenoxyethanol, Caprylyl Glycol, Althaea Officinalis (Marshmallow) Root Extract, Parfum, Hyaluronic Acid, Caprylyl/Capryl Glucoside, Hydrolised Silk Protein.

Net Weight: 10ml per shield mask

Sunday,Monday,Tuesday,Wednesday,Thursday,Friday,Saturday
January,February,March,April,May,June,July,August,September,October,November,December
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return To Shop

Add Order Note Edit Order Note
Estimate Shipping

Estimate Shipping

Royal Nectar Shield Mask

$6.00