Aotea WellnessAotea WellnessAotea Wellness

Me Today Men's Daily 60 Veg Capsules

Excl. GST

$34.70

Shipping calculated at checkout.
SKU: 1918-1152564N/A
Out of stock
Parcels normally take 1-3 business days to arrive within New Zealand or 7-14 business days to arrive in other destinations, depending on where you are located.

*During the holiday seasons, we kindly ask for your understanding as shipping and fulfillment times may be extended.* hoursminutes

american expressjcbapple paymasterpaypalvisaalipaywechatpay
  • Assists general health & wellbeing
  • Supports energy production
  • Supports immune function

Men’s Daily is your premium quality formula containing 27 vitamins, 1minerals & herbs for your general health & wellbeing.

Formulated for your busy lifestyle with a blend of powerful antioxidants from lycopene, ginseng & bioflavonoids.

Adults take: 1 vege cap daily with food or as directed by your healthcare professional.

Each tablet contains:

Betacarotene 5mg
Thiamine Hydrochloride (Vitamin B1 30mg) 33.63mg
Riboflavin (Vitamin B2) 30mg
Nicotinamide (Vitamin B3) 30mg
Calcium Pantothenate (Vitamin B5 64mg) 69.86mg
Pyridoxine Hydrochloride (Vitamin B6 10mg) 12.15mg
Folic Acid 200 micrograms
Cyanocobalamin (Vitamin B12) 30 micrograms
Ascorbic Acid (Vitamin C) 100mg
Colecalciferol (Vitamin D3 500IU) 12.5 micrograms
d-alpha Tocopheryl Acid Succinate (Vitamin E 25IU) 20.66mg
Biotin 50 micrograms, Choline Bitartrate 10mg
Inositol 10mg, Calcium Carbonate (Calcium 30.84mg) 50mg
Chromium Picolinate (Chromium 25 micrograms) 206 micrograms
Copper Gluconate (Copper 1.5mg) 10.71mg
Potassium Iodide (Iodine 50 micrograms) 65 micrograms
Manganese Sulfate Monohydrate (Manganese 1.8mg) 5.54mg
Magnesium Oxide (Magnesium 75mg) 124.38mg
Selenomethionine (Selenium 55 micrograms) 137.5 micrograms
Zinc Citrate Dihydrate (Zinc 7.5mg) 23.36mg
Citrus Bioflavonoids Extract 10mg
Ubidecarenone (Co-enzyme Q10) 2mg
Panax Ginseng extract 40mg from dry root 400mg
Eleutherococcus senticosus (Ginseng) extract 26.67mg from dry root 400mg
Lycopersicon esculentum (Tomato) extract 20mg from dry fruit 400mg equiv.
Lycopene 1mg
Croscarmellose sodium
Colloidal anhydrous silica
Magnesium stearate

Also contains: Hypromellose, titanium dioxide, sorbitol, silicon dioxide, purified water.

 

Sunday,Monday,Tuesday,Wednesday,Thursday,Friday,Saturday
January,February,March,April,May,June,July,August,September,October,November,December
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return To Shop

Add Order Note Edit Order Note
Estimate Shipping

Estimate Shipping

Me Today Men's Daily 60 Veg Capsules

$34.70