Aotea WellnessAotea WellnessAotea Wellness

Me Today Energise 60 vege capsules

Excl. GST


Shipping calculated at checkout.
SKU: 1918-1152655N/A
Out of stock
Parcels normally take 1-3 business days to arrive within New Zealand or 7-14 business days to arrive in other destinations, depending on where you are located.

*During the holiday seasons, we kindly ask for your understanding as shipping and fulfillment times may be extended.* hoursminutes

american expressjcbapple paymasterpaypalvisaalipaywechatpay
  • Supports energy production
  • Support during stress
  • Supports adrenal glands health

Me Today Energise Complex is your premium quality formula based on scientific and traditional evidence, containing all B vitamins plus adaptogenic herbs Siberian ginseng and ashwagandha. Formulated to support your energy production and provide you support during stressful times. Unlocking your best tomorrow.

Adults take: 1 vege cap daily with food or as directed by your healthcare professional.

Each tablet contains:

Vitamin B1 (Thiamine Hydrochloride) 75mg
Vitamin B2 (Riboflavin) 12.5mg
Vitamin B3 (Nicotinamide) 100mg
Vitamin B5 (Calcium Pantothenate) 75mg
Vitamin B6 (Pyridoxine Hydrochloride) 25mg
Folic acid 200mcg
Vitamin B12 (Cyanocobalamin) 30mcg
Vitamin C (Ascorbic Acid) 135mcg
Vitamin E (dl-alpha Tocopheryl Acetate 50mg)
50IU Biotin 50mcg
Choline Bitartrate 25mg
Inositol 25mg
Zinc Amino Acid Chelate 37.5mg Equiv. Zinc 7.5mg
Ginseng (Eleutherococcus Senticosus) ext. equiv. to dry root 200mg
Ashwagandha (Withania Somnifera) ext. equiv. to dry root 150mg
Croscarmellose sodium
Colloidal anhydrous silica
Magnesium stearate

Also contains: 100% Hypromellose.
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return To Shop

Add Order Note Edit Order Note
Estimate Shipping

Estimate Shipping

Me Today Energise 60 vege capsules
