Aotea WellnessAotea WellnessAotea Wellness

Me Today Becalm 60 vege capsules

Excl. GST


Shipping calculated at checkout.
SKU: 1918-1152659N/A
Out of stock
Parcels normally take 1-3 business days to arrive within New Zealand or 7-14 business days to arrive in other destinations, depending on where you are located.

*During the holiday seasons, we kindly ask for your understanding as shipping and fulfillment times may be extended.* hoursminutes

american expressjcbapple paymasterpaypalvisaalipaywechatpay
  • Relaxes body & mind
  • Relaxes muscular tension & tightness
  • Helps ease stress, worry & tension

Me Today Becalm Complex is your premium quality formula based on scientific and traditional evidence to help relax your body and mind. Magnesium helps relax tight and tense muscles, while turmeric used in Ayurvedic practice supports stiff and tired joints. Lemon balm is traditionally used in Western herbal practice to help calm mental stress. Unlocking your best tomorrow.

Each tablet contains:
Turmeric (Curcuma Longa) rhizome ext. equiv. to dry root 7894mg
Equiv. Curcuminoids 300mg
Lemon Balm (Melissa Officinalis) ext. equiv. to dry leaf 1500mg
Magnesium Amino Acid Chelate 1000mg Equiv. Magnesium 200mg
BioPerine® Black Pepper (Piper Nigrum) ext. 4mg
Calcium hydrogen phosphate dihydrate
Magnesium stearate
Colloidal anhydrous silica
Also contains: Vege capsule.
Adults take: 1 vege cap daily with food or as directed by your healthcare professional.
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return To Shop

Add Order Note Edit Order Note
Estimate Shipping

Estimate Shipping

Me Today Becalm 60 vege capsules
