Aotea WellnessAotea WellnessAotea Wellness

Me Today Beauty 60 vege capsules

Excl. GST

$34.70

Shipping calculated at checkout.
SKU: 1918-1152657N/A
Out of stock
Parcels normally take 1-3 business days to arrive within New Zealand or 7-14 business days to arrive in other destinations, depending on where you are located.

*During the holiday seasons, we kindly ask for your understanding as shipping and fulfillment times may be extended.* hoursminutes

american expressjcbapple paymasterpaypalvisaalipaywechatpay
  • Supports hair & skin health
  • Strengthens soft brittle nails
  • Provides antioxidant support

Me Today Beauty Complex is your premium quality formula containing essential nutrients to assist with healthy maintenance of your hair, skin and nails. Vitamin C plays a role in collagen production, important to help maintain your skin integrity and appearance. Biotin helps strengthen your nails and reduce breaking. Unlocking your best tomorrow.

Adults take: 1 vege capsule daily with food or as directed by your healthcare professional.

Each tablet contains:

Vitamin C (Ascorbic acid) 250mg

Hydrolysed Collagen 225mg
Silica-Colloidal Anhydrous 45.53mg Equiv. Silica 20mg
Vitamin E (dl-alpha tocopheryl acetate 25mg)
25IU Zinc Amino Acid Chelate 75mg Equiv. Zinc 15mg
Selenomethionine 10mg Equiv. Selenium 50mcg
Biotin 1.3mg Magnesium stearate

Also contains: Hypromellose, purified water, gellan gum.

Contains encapsulating aids and fish products.

No added gluten, dairy, egg, soy or yeast.
Sunday,Monday,Tuesday,Wednesday,Thursday,Friday,Saturday
January,February,March,April,May,June,July,August,September,October,November,December
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return To Shop

Add Order Note Edit Order Note
Estimate Shipping

Estimate Shipping

Me Today Beauty 60 vege capsules

$34.70