Aotea WellnessAotea WellnessAotea Wellness

Nature's Beauty Revitox Anti Ageing Serum 30ml

Excl. GST

$61.65

Shipping calculated at checkout.
SKU: 113-RE72N/A
Out of stock
*Due to increased holiday demand, we kindly ask for your understanding as shipping and fulfillment times may be extended.*
Parcels normally take 1-3 business days to arrive within New Zealand or 7-14 business days to arrive in other destinations, depending on where you are located. hoursminutes

american expressjcbapple paymasterpaypalvisaalipaywechatpay

This product cannot be shipped to the USA

Fight the signs of ageing with the power of science using the latest innovations in anti-ageing with our REVITOX Anti-Ageing serum. Specifically formulated to provide the ultimate cosmetic treatment for minimising and preventing facial wrinkles without the need for expensive treatments, this intensive anti-ageing serum boasts the pairing Argireline and Antarctacine to provide effective results.

A protein derived from Amino Acids, Argireline works with the skin to reduce the force that facial muscles contract with, thereby promoting wrinkle reduction and reducing cellular damage. This wonder ingredient is combined with the regenerating effects of Antarctacine, a beneficial ingredient found to help the skin retain water, increase collagen and elastin, and aid in tissue regeneration to promote skin healing and reduce the depth of wrinkles, especially on the forehead and around the eyes.

Further enhanced with the hydrating effects of Allantoin, a ƒ??miracle ingredientƒ?? found to help stimulate skin healing and strengthen skin tissue, this concentrated formula absorbs quickly into the skin to help relax the facial muscles and accelerate cell growth to restore volume to the skin, promoting smoother, healthier looking skin with a radiant glow.

Directions:
Use clean finger tips to dab small amounts to cleansed and slightly moist face, then use short but firm strokes to apply serum to the face and forehead.
Allow serum to fully absorb before applying moisturiser, gently tapping the skin can help encourage deeper absorption.
Always patch test skincare products before full use.

30ml
Made in New Zealand

Ingredients: Aqua (Water), Glycerine, Acetyl Hexapeptide-8 (and) Caprylyl Glycol (Argireline), Nonoxynol-15, Pseudoalteromonas Ferment Extract & Caprylyl Glycol (Antarcticine), Polysorbate 20, Triethanolamine, Acrylates C10-C30 Alkyl Acrylates Crosspolymer, Hydrolysed Collagen, Phenoxyethanol, Methyl Paraben, Ethyl Paraben, Propyl Paraben, Butyl Paraben, Retinyl Palmitate (Vitamin A), Tocopherol Acetate (Vitamin E), Diazolidinyl Urea, Fragrance.

Sunday,Monday,Tuesday,Wednesday,Thursday,Friday,Saturday
January,February,March,April,May,June,July,August,September,October,November,December
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return To Shop

Add Order Note Edit Order Note
Estimate Shipping

Estimate Shipping

Nature's Beauty Revitox Anti Ageing Serum 30ml

$61.65