Sold out

Antipodes Joyful Hand & Body Cream 120ml

Excl. GST

$37.30

Tax included. Shipping calculated at checkout.
SKU: 1840-ANT160N/A

Notify me when this product is available:

american expressjcbapple paymasterpaypalvisaalipaywechatpay

Antipodes Joyful Hand & Body Cream reminds us of glorious Summer blackcurrant flirting with South Pacific hibiscus bloom. Avocado oil delivers an immediate boost of hydration to dry, tired and stressed skin. This captivating and velvety cream will leave your skin dewy, fragrant and free from oily residue.

Key Ingredients;

  • Avocado oil
  • Wild blackcurrant berry
  • Hibiscus flower

Pure Plant Fragrance: Wild blackcurrant

Made in New Zealand.
e120ml / 4.0 fl oz

Sunday,Monday,Tuesday,Wednesday,Thursday,Friday,Saturday
January,February,March,April,May,June,July,August,September,October,November,December
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return To Shop

Add Order Note Edit Order Note
Estimate Shipping

Estimate Shipping