Aotea WellnessAotea WellnessAotea Wellness

Sheep Whole Milk Powder - 700g 6PK + International Freight to Mainland China

Excl. GST


Shipping calculated at checkout.
SKU: 1794-WPN700-6PKN/A
Out of stock
Parcels normally take 1-3 business days to arrive within New Zealand or 7-14 business days to arrive in other destinations, depending on where you are located.

*During the holiday seasons, we kindly ask for your understanding as shipping and fulfillment times may be extended.* hoursminutes

american expressjcbapple paymasterpaypalvisaalipaywechatpay

Sheep Whole Milk Powder - 700g 6PK + International Freight to Mainland China

Why sheep milk?
  • Great nutrition¶ÿ
  • Almost two times more protein than cows milk
  • Very Low Sodium
  • High in protein High Calcium
  • Higher conjugated linoleic acid than cow milk (CLA)
  • (CLA) is a cancer fighting fat reducing fat
Sheep milk nutritionally out-performs goat & cows milk in almost all areas:
  • 44% more Energy than cows milk
  • 45% more Protein than cows milk
  • 50% more Iron than cow or goats milk
  • 38% more Calcium
  • 90% more Folic Acid than goats milk (similar levels in cows milk)
  • 50% more Vitamin B12 than cows milk
  • Higher levels of key vitamins A, D, E & C than both cow & goats milk
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return To Shop

Add Order Note Edit Order Note
Estimate Shipping

Estimate Shipping

Sheep Whole Milk Powder - 700g 6PK + International Freight to Mainland China
