Aotea WellnessAotea WellnessAotea Wellness

Buy 3 Get 1 Free - Go Healthy Co-Q10 300mg +VitD 1000IU 60 capsules

Excl. GST

$225.74 $169.30

Shipping calculated at checkout.
SKU: 1825-GO1362-4PKN/A
Out of stock
Parcels normally take 1-3 business days to arrive within New Zealand or 7-14 business days to arrive in other destinations, depending on where you are located.

*During the holiday seasons, we kindly ask for your understanding as shipping and fulfillment times may be extended.* hoursminutes

american expressjcbapple paymasterpaypalvisaalipaywechatpay

Supports energy and healthy cholesterol levels, promotes antioxidant health.

GO CO-Q10 300mg + VITAMIN D3 is a superior strength, heart health and energy formula, supplied in a convenient, easy to swallow 1-A-Day softgel capsule dose. Each capsule contains 300mg of Co-Enzyme Q10 plus 1,000U of Vitamin D3 for extra heart support.

  • Clinical strength Co-Q10
  • Naturally fermented
  • Supplied in oil form to further enhance absorption
  • Supports healthy heart function


  • Co-Enzyme Q10: 300mg
  • Vitamin D3: 1000IU

Suggested Usage;
Adults: Take 1 SoftGel Cap daily. Best taken with food. Or as directed by your Healthcare Professional.


  • Not to be taken during pregnancy or lactation.
  • Do not take if on blood thinning medication without medical advice.
  • Always read the label. Take only as directed.
  • If taking prescription medication or if in doubt consult your Healthcare Professional.
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return To Shop

Add Order Note Edit Order Note
Estimate Shipping

Estimate Shipping

Buy 3 Get 1 Free - Go Healthy Co-Q10 300mg +VitD 1000IU 60 capsules

$225.74 $169.30