Aotea WellnessAotea WellnessAotea Wellness

ASTAS True Radiance Program (30 days pack)

Excl. GST

$120.87

Tax included. Shipping calculated at checkout.
SKU: 1801-ASTAS GIFT PACKN/A
Out of stock
Parcels normally take 1-3 business days to arrive within New Zealand or 7-14 business days to arrive in other destinations, depending on where you are located.

*During the holiday seasons, we kindly ask for your understanding as shipping and fulfillment times may be extended.* hoursminutes

american expressjcbapple paymasterpaypalvisaalipaywechatpay

ASTAS - True Radiance Program - 30 days pack

ASTAS True Radiance is a 30 day Program combining three scientific formulas using the power of natural Astaxanthin, designed to nourish and protect your skin from the inside and out. Each 30 day program pack contains 1 x Serum, 1 x Moisturiser, and 1 x 30 Capsules.

TRUE RADIANCE SERUM

Deeply penetrates your skin, delivering maximum concentrations of Natural Astaxanthin and bioactives creating a smoother, more even complexion.

Ritual: Apply 1 pump of True Radiance Serum to crease areas daily, morning and night after cleansing. Follow with True Radiance Moisturiser.

All Natural Ingredients: Aqua, Rose Water, Olivem 1000, Caprylic / Capric Triglyceride, Organic Glycerine, Organic Jojoba Oil, Organic Apricot Oil, Meadowfoam Seed Oil, Kiwifruit Extract, Astaxanthin, Vitamin E Acetate, Organic Tamanu Seed Oil, Green Tea Extract, Vitamin A Palmitate, Pomegranate Seed Extract, Tocotrienol, Hyaluronic Acid, Sodium Benzoate, Bisabolol, Potassium Sorbate, Dehydroxanthan Gum, Xanthan Gum, Dehydroacetic Acid Benzyl Alcohol, Sodium Ascorbyl Phosphate.

Size: 15 ml / 0.5 fl.oz.

TRUE RADIANCE MOISTURISER

Luxuriously smooth moisture for day and night. Formulated with the power of Natural Astaxanthin and designed to nourish and protect. Leaves your skin feeling firmer, more plumped and truly radiant.

Ritual: Apply 2 pumps of True Radiance Moisturiser daily, morning and night after applying True Radiance Serum.

All Natural Ingredients: Aqua, Rose Water, Olivem 1000, Organic Avocado Oil, Cetyl Alcohol , Organic Glycerine, Myristyl Myristate, Organic Jojoba Oil, Glyceryl Stearate, Organic Evening Primrose Oil, Vitamin B3, Kiwifruit Extract, Astaxanthin, Organic Argan Oil, Organic Tamanu Seed Oil, Tocotrienol, Manuka Honey, Pro-Vitamin B5, Organic Aloe Vera Extract, Natural Fragrance, Hyaluronic Acid, Hydrolyzed Wheat Protein, Xanthan Gum, Bisabolol, Dehydroacetic Acid Benzyl Alcohol, Sodium Ascorbyl Phosphate.

Size: 30 ml / 1.0 fl.oz.

TRUE RADIANCE CAPSULES

Advanced nutrition with Natural Astaxanthin, vitamins and extracts - giving you healthy, beautiful, radiant skin from the inside. Working at a cellular level, the scientifically formulated capsules support cell repair in all layers of the skin.

Ritual: Take one True Radiance capsule with food.

All Natural Ingredients: Vitamin C, Vitamin E, Kiwifruit Seed Extract, Natural Astaxanthin, Phosphatidylcholine, Retinol. Other Ingredients: Encapsulating Aid, Olive Oil, Beeswax.

Precautions: Supplements should not replace a balanced, healthy diet. Contains beeswax and kiwifruit seed extract, which can cause severe allergic reactions. Not recommended for use during pregnancy or breast feeding. Keep out of reach of children. No added gluten, dairy, yeast, sugar or artificial colours.

Size: 30 capsules

Sunday,Monday,Tuesday,Wednesday,Thursday,Friday,Saturday
January,February,March,April,May,June,July,August,September,October,November,December
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return To Shop

Add Order Note Edit Order Note
Estimate Shipping

Estimate Shipping

ASTAS True Radiance Program (30 days pack)

$120.87