Aotea WellnessAotea WellnessAotea Wellness

Me Today Goodnight 60 Vege Capsules

Excl. GST

$34.70

Tax included. Shipping calculated at checkout.
SKU: 1918-1152656N/A
Out of stock
Parcels normally take 1-3 business days to arrive within New Zealand or 7-14 business days to arrive in other destinations, depending on where you are located.

*During the holiday seasons, we kindly ask for your understanding as shipping and fulfillment times may be extended.* hoursminutes

american expressjcbapple paymasterpaypalvisaalipaywechatpay
  • Helps support restful sleep
  • Supports mind relaxation
  • Calms restlessness

Goodnight is your premium quality formula based on scientific and traditional evidence, designed for you to support refreshing sleep. Magnesium helps your muscles relax & function when dietary intake is inadequate.

Valerian helps calm your mind and relieves nervous tension & restlessness.

How to use:
Adults take 1 vege cap an hour before bed or as directed by your healthcare professional.
Take only as directed and in conjunction with a healthy balanced diet. 


Each Vege Cap Contains: Valerian (Valeriana officinalis) ext. equiv. to dry root 1000mg, Magnesium Amino Acid Chelate 500mg, equiv. Magnesium 100mg, Passionflower (Passiflora incarnata) ext. equiv. to dry herb 500mg. Contains encapsulating aids and soy bean products. No added gluten, dairy or egg. Vegan friendly formula.

This ingredient list is subject to change, customers should refer to the product packaging for the most up-to-date ingredient list.

Sunday,Monday,Tuesday,Wednesday,Thursday,Friday,Saturday
January,February,March,April,May,June,July,August,September,October,November,December
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return To Shop

Add Order Note Edit Order Note
Estimate Shipping

Estimate Shipping

Me Today Goodnight 60 Vege Capsules

$34.70