Aotea WellnessAotea WellnessAotea Wellness
Aotea WellnessSearch
0
Go Healthy Go Probiotic 40 Billion-30 Vege CapsulesBack to Health - General HealthMe Today Energise 60 vege capsules

Me Today Becalm 60 vege capsules

Excl. GST

$34.70

Tax included. Shipping calculated at checkout.
SKU: 1918-1152659N/A
Out of stock
Add to Wishlist
Parcels normally take 1-3 business days to arrive within New Zealand or 7-14 business days to arrive in other destinations, depending on where you are located.

*During the holiday seasons, we kindly ask for your understanding as shipping and fulfillment times may be extended.* hoursminutes

american expressjcbapple paymasterpaypalvisaalipaywechatpay
Description
  • Relaxes body & mind
  • Relaxes muscular tension & tightness
  • Helps ease stress, worry & tension

Me Today Becalm Complex is your premium quality formula based on scientific and traditional evidence to help relax your body and mind. Magnesium helps relax tight and tense muscles, while turmeric used in Ayurvedic practice supports stiff and tired joints. Lemon balm is traditionally used in Western herbal practice to help calm mental stress. Unlocking your best tomorrow.

Each tablet contains:
Turmeric (Curcuma Longa) rhizome ext. equiv. to dry root 7894mg
Equiv. Curcuminoids 300mg
Lemon Balm (Melissa Officinalis) ext. equiv. to dry leaf 1500mg
Magnesium Amino Acid Chelate 1000mg Equiv. Magnesium 200mg
BioPerine® Black Pepper (Piper Nigrum) ext. 4mg
Calcium hydrogen phosphate dihydrate
Magnesium stearate
Colloidal anhydrous silica
Also contains: Vege capsule.
Adults take: 1 vege cap daily with food or as directed by your healthcare professional.
Reviews
Sunday,Monday,Tuesday,Wednesday,Thursday,Friday,Saturday
January,February,March,April,May,June,July,August,September,October,November,December
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return To Shop

Enable cookies to use the shopping cart
Add Order Note Edit Order Note
Estimate Shipping
Subtotal:
$0.00

Tax included. Shipping calculated at checkout.

View cart

All charges are billed in NZD. While the content of your cart is currently displayed in , the checkout will use NZD at the most current exchange rate.

Estimate Shipping

Me Today Becalm 60 vege capsules

$34.70
We use cookies to improve your experience on our website. By browsing this website, you agree to our use of cookies.
Accept