Aotea WellnessAotea WellnessAotea Wellness

Hauora Colostrum 120000mg/KG Gift Pack

Excl. GST

$479.65 $359.91

Tax included. Shipping calculated at checkout.
SKU: 1823-F4379G1N/A
Out of stock
Parcels normally take 1-3 business days to arrive within New Zealand or 7-14 business days to arrive in other destinations, depending on where you are located.

*During the holiday seasons, we kindly ask for your understanding as shipping and fulfillment times may be extended.* hoursminutes

american expressjcbapple paymasterpaypalvisaalipaywechatpay

Colostrum is a pre-milk fluid produced by mammals during the first 12-24 hours after giving birth, and contains immune supporting properties. These chewable colostrum tablets contain growth factors that nutritionally support the body's digestive and immune systems.

  • Contains protein, vitamins, minerals and immune enhancing factors
  • Helps prevent infection
  • Improves the performance of athletes through improved muscle power and endurance and reduced recovery time.
Sunday,Monday,Tuesday,Wednesday,Thursday,Friday,Saturday
January,February,March,April,May,June,July,August,September,October,November,December
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return To Shop

Add Order Note Edit Order Note
Estimate Shipping

Estimate Shipping

Hauora Colostrum 120000mg/KG Gift Pack

$479.65 $359.91