website

Go Healthy Co-Q10 300mg VitD 1000IU 60 caps

Excl. GST

$78.17

Tax included. Shipping calculated at checkout.
SKU: 1825-GO1362N/A
Out of stock
Parcels normally take 1-3 days to arrive within New Zealand or 3-14 days to arrive in other destinations, depending on where you are located. hoursminutes

american expressjcbapple paymasterpaypalvisaalipaywechatpay

Supports energy and healthy cholesterol levels, promotes antioxidant health.

Go Co-Q10 300mg + Vit D3 is a superior strength, heart health and energy formula, supplied in a convenient, easy to swallow 1-A-Day softgel capsule dose. Each capsule contains 300mg of Co-Enzyme Q10 plus 1,000U of Vitamin D3 for extra heart support.

  • Clinical strength Co-Q10
  • Naturally fermented
  • Supplied in oil form to further enhance absorption
  • Supports healthy heart function

Ingredients;

  • Co-Enzyme Q10: 300mg
  • Vitamin D3: 1000IU

Suggested Usage;
Adults: Take 1 SoftGel Cap daily. Best taken with food. Or as directed by your Healthcare Professional.

Precautions;

  • Not to be taken during pregnancy or lactation.
  • Do not take if on blood thinning medication without medical advice.
  • Always read the label. Take only as directed.
  • If taking prescription medication or if in doubt consult your Healthcare Professional. 
Sunday,Monday,Tuesday,Wednesday,Thursday,Friday,Saturday
January,February,March,April,May,June,July,August,September,October,November,December
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return To Shop

Add Order Note Edit Order Note
Estimate Shipping

Estimate Shipping

Go Healthy Co-Q10 300mg VitD 1000IU 60 caps

$78.17