Wild Ferns Lanolin Serum Set: Moisturising Facial Lotion, Facial Serum, Eye Serum

Excl. GST

$42.52 $31.89

Shipping calculated at checkout.
SKU: 169-LASSETN/A
Out of stock
Parcels normally take 1-3 days to arrive within New Zealand or 3-14 days to arrive in other destinations, depending on where you are located. hoursminutes

american expressjcbapple paymasterpaypalvisaalipaywechatpay

Wild Ferns-Lanolin Serum Set-Moisturising Facial Lotion-100ml, Facial Serum-30ml, Eye Serum-15ml

Lanolin Moisturising Facial Lotion with Green Tea and Manuka Honey-100ml

Help nourish and enrich your skin with hydrating and nourishing Lanolin combined with Manuka Honey - renowned for its restorative and healing effects. Green Tea, rich in antioxidants, works to shield the skin against everyday environmental damage. This is a moisturiser that calms the skin and gently restores a more youthful glow. With the difference between a face lotion and a crème being its oil to water ratio, a lotion has less oil so is much lighter on the skin. It absorbs quickly and leaves very little residue. This is a fantastic option
during the warmer more humid months or when your skin type has changed due to the climate.

Directions
After cleansing apply a small amount of lotion and gently smooth in an upward direction onto the face and neck. May be used morning or night.

97% Natural

100ml/3.38oz


Lanolin Facial Serum with Royal Jelly and Rosehip Oil-30ml

Ultra-restorative, this Lanolin facial serum utilises only the best ingredients. Royal Jelly, having powerful moisturising properties assists in the deep conditioning of the skin, while Vitamins A, C and E stimulate collagen production; and cellular rejuvenation is enhanced. Antioxidant and moisture rich Rosehip Oil has the ability to penetrate into the deep layers of the skin providing ultimate hydration and collagen production.

Directions
Apply 2 – 3 drops to cleansed skin. Using one or two fingers massage into the face in an upward direction avoiding the eye area. Use 2 – 3 times per week. Apply morning or night before your favourite Wild Ferns moisturiser/night crème. May be used more often if required.

95% Natural

30ml/1.01oz


Lanolin Eye Serum with Royal Jelly and Green Tea-15ml

A concentrated eye serum containing moisturising Lanolin and nutritious Royal Jelly; this eye serum is designed to help in diminishing the appearance of fine lines. With the skin under your eye being 10 times thinner than the rest of your face it is important to pay extra special attention to this area. Soothing Cucumber, Aloe Vera and Chamomile extract is complemented with Green Tea, which contains large amounts of antioxidants helping to eliminate the free radicals that causes skin damage around the delicate area of the eye. This light formula penetrates quickly into the skin; making it perfect for wearing under makeup in the morning, or as an intensive treatment at night.

Directions
Apply a small amount to your ring fingers (these have the least amount of strength). Use a light patting motion under and around the eye area. Press or tap but do not rub.

98% Natural

15ml/0.50oz

All

  • Paraben Free
  • No Mineral Oil
  • No tested on Animals

Made in New Zealand

Sunday,Monday,Tuesday,Wednesday,Thursday,Friday,Saturday
January,February,March,April,May,June,July,August,September,October,November,December
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return To Shop

Add Order Note Edit Order Note
Estimate Shipping

Estimate Shipping

Wild Ferns Lanolin Serum Set: Moisturising Facial Lotion, Facial Serum, Eye Serum

$42.52 $31.89