Jema Rose - 8+ Minute Replenishing Hydration Mask 7pcs

Excl. GST


Shipping calculated at checkout.
Out of stock
Parcels normally take 1-3 days to arrive within New Zealand or 3-14 days to arrive in other destinations, depending on where you are located. hoursminutes

american expressjcbapple paymasterpaypalvisaalipaywechatpay


Our replenishing mask allows the active ingredients to deeply hydrate and replenish your skin. Treating your skin with our masks helps clear skin pores and keeps your skin rejuvenated and nourished.

Natural Ingredients;

  • HYALURONIC ACID: The key molecule involved in skin moisture.
  • CAVIAR EXTRACT: Caviar extract contains antioxidant properties to protect skin.
  • TREMELLA FUCIFORMIS: Credited  with helping to maintaining a youthful appearance.
  • TUBER MAGNATUM EXTRACT: Effectively in moisturising and nourishing the skin
  • HYDROLYSED SILK: Silk protein,  excellent moisture binding properties
  • Widely used anti-inflammatory agent isolated from the liquorice root.

1 Box: 7 face masks

Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return To Shop

Add Order Note Edit Order Note
Estimate Shipping

Estimate Shipping

Jema Rose - 8+ Minute Replenishing Hydration Mask 7pcs
