Aotea WellnessAotea WellnessAotea Wellness

Good Health Oyster plus 60caps

Excl. GST

$30.35

Shipping calculated at checkout.
SKU: 854-FEU10100N/A
Out of stock
*Due to increased holiday demand, we kindly ask for your understanding as shipping and fulfillment times may be extended.*
Parcels normally take 1-3 days to arrive within New Zealand or 3-14 days to arrive in other destinations, depending on where you are located. hoursminutes

american expressjcbapple paymasterpaypalvisaalipaywechatpay

Oyster plus is a natural source of marine nutrients including Zinc and Taurine to benefit health and vitality. Extra zinc has been added for reproductive and immune support. Oyster plus is derived from oysters grown in the clean coastal waters of New Zealand for optimal purity.

Added Zinc for male vitality

  • Reproductive and immune suppor
  • Natural source of marine nutrients
  • Derived from New Zealand coastal grown oyster
  • Supports health and vitality

Available in 60 capsules

Directions: Adults: Take 1 to 2 capsules daily or as professionally advised. Capsules may be opened and contents added to food.

Ingredients: (per capsule)
Freeze Dried Oyster Powder

350mg

Zinc Oxide (Equiv. Zinc 7mg)

8.8mg

Oyster naturally provides key nutrients such as:

Mineral salts (Phosphorus, Calcium, Potassium, Iron, Magnesium, Sodium, Copper, Manganese, Zinc, Cobalt,Iodine), Vitamins (Vitamin B6, Riboflavin, Vitamin B12, Biotin, Chlorine), Amino acids (Taurine, Glycogen, Aspartic Acid, Glutamine Acid, Serine, Glycine, Histine, Arginine, Threonine, Alanine, Proline, Tyrosine, valine, Methionine, Isoeucine, Leucine, Phenlylalanine, Lycine).

¶ÿ

Nutrition Information:

Serving per carton:30

Serving size 1 capsule

*Qty per serving *Qty per 100g
Energy 6.89kj 1590kj
Protein 0.23g 53g
Fat, total <0.1g 9.3g
-saturated <0.1g 4.0g
Carbohydrates 0.14g 32.3g
-sugars 0.1g 6.8g
Sodium 20mg 4630mg

*All specified values are averages

Caution: People allergic to shellfish should avoid use.

  • Do not use if cap seal is broken.
  • No artificial flavours, sweeteners, preservatives or colours used in this product.
Sunday,Monday,Tuesday,Wednesday,Thursday,Friday,Saturday
January,February,March,April,May,June,July,August,September,October,November,December
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return To Shop

Add Order Note Edit Order Note
Estimate Shipping

Estimate Shipping

Good Health Oyster plus 60caps

$30.35