Aotea WellnessAotea WellnessAotea Wellness
Sold out

Good Health Colostrum Milk Chews -Strawberry flavour 150tabs

Excl. GST

$26.00 $18.20

Shipping calculated at checkout.
SKU: 854-FAN10200N/A

Notify me when this product is available:

american expressjcbapple paymasterpaypalvisaalipaywechatpay

Strawberry flavour

  • Contains highly nutritive colostrum
  • Sourced from pasture fed cows
  • Wide range of immune factors
  • Rich in growth & repair factors

Colostrum is the enriching 'first milk' received by nursing young to naturally assist immune development and natural growth. Good Health Colostrum is sourced from pasture-raised dairy cows. Colostrum chews are a tasty way for adults and children to enjoy the health benefits of Colostrum.

Available in 150 Chewable tablets. Also available in vanilla flavour.

Directions: Adults and children: Take 5 tablets daily or as professionally advised.

Ingredients: Dextrose, Whey Powder (19%), Sorbitol, Colostrum Powder (13%), Calcium Carbonate, Skim Milk Powder (4%), Vanilla flavour, Beetroot Powder (natural colour), Strawberry Flavour, Silicon Dioxide.

Nutrition information:
Servings per bottle: 30
Serving size: 5 tablets (5400mg)



*Qty per serving *Qty per 100g
Energy

73kJ

1350kJ

Protein

0.6g

11.6g

Fat, total

0.1g

1.7g

- Saturated

0.1g

1.6g

Carbohydrate

3.8g

71.0g

- Sugars

2.7g

49.9g

Sodium

14mg

262mg

Calcium

222mg

4110mg

Vitamin B12

0.3mcg

5mcg

IgG

120mg

2220mg

IgA

9mg

166mg

IgM

2mg

33mg

Lactoferrin

1mg

13mg

*All specified values are averages.

Contains milk products. May contain traces of soy.

Do not use if cap seal is broken. No artificial flavours, sweeteners, perservatives or colours used in this product. Made in New Zealand from local and imported ingredients. Please recycle. Plastic production & transport require less energy than glass.

Store below 30 degrees in a dry place.

Sunday,Monday,Tuesday,Wednesday,Thursday,Friday,Saturday
January,February,March,April,May,June,July,August,September,October,November,December
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return To Shop

Add Order Note Edit Order Note
Estimate Shipping

Estimate Shipping