Go Healthy Breathe Clear 60 vege capsules

Excl. GST

$46.00

Shipping calculated at checkout.
SKU: 1825-GO1154N/A
Out of stock
Parcels normally take 1-3 days to arrive within New Zealand or 3-14 days to arrive in other destinations, depending on where you are located. hoursminutes

american expressjcbapple paymasterpaypalvisaalipaywechatpay

Clear airways for healthy lungs and ongoing support for overall respiratory health.

GO BREATHE CLEAR is a comprehensive formulation that provides natural support for healthy respiratory and pulmonary function. The combined ingredients help to support lung health, clear airways and healthy breathing.

  • Natural complete support for healthy lung function.
  • Supports normal, healthy breathing.
  • Supports lung health and clear airways.
  • VegeCap Advantage.

Ingredients: Adhatoda (equiv. to 250mg), Albizzia (equiv. to 100mg), Baical Skullcap (equiv. to 200mg), Boswellia (equiv. to 200mg), Bromelain 50mg, Chamomile (equiv. to 50mg), Echinacea (equiv. to 100mg), Elecampane (equiv. to root 100mg), Ginger (equiv. to 50mg), Hesperidin 25mg, Magnesium amino acid chelate 150mg, Marshmallow (equiv. to 200mg), Passionflower (equiv. to 50mg), Quercetin (equiv. to 250mg), Selenium 50mcg, Thyme (equiv. to 150mg), Vitamin C 150mg, Vitamin E 50IU

Suggested Usage;
Adults: Take 1 VegeCap daily. A maximum of 2 VegeCaps can be taken daily during an acute onset.

Children: Age 12+ Take 1 VegeCap daily. May be taken anytime, with food. Or as directed by your Healthcare Professional.

Precautions;

  • Breathing difficulties must be checked out by a Healthcare Professional.
  • Not to be taken during pregnancy or lactation.
  • Always read the label. Take only as directed.
  • If taking prescription medication or if in doubt, please consult your Healthcare Professional.
Sunday,Monday,Tuesday,Wednesday,Thursday,Friday,Saturday
January,February,March,April,May,June,July,August,September,October,November,December
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return To Shop

Add Order Note Edit Order Note
Estimate Shipping

Estimate Shipping

Go Healthy Breathe Clear 60 vege capsules

$46.00