[Clearance Sale] Dr Lancy Noni Juice 30ml x 30 pack

Excl. GST

$98.00 $15.00

Shipping calculated at checkout.
Out of stock
Parcels normally take 1-3 days to arrive within New Zealand or 3-14 days to arrive in other destinations, depending on where you are located. hoursminutes

american expressjcbapple paymasterpaypalvisaalipaywechatpay

Noni Juice is manufactured in New Zealand.

100% purely from Organic Noni Juice of the Cook Islands. No water, no sugar and no additives have been added.

  • Super fruit
  • Detox
  • Body Shape
  • Ingredients: 100% Pure Cook Islands Noni Juice
Energy 25.6kj
Protein 0.10g
Fat - Total < 0.02g
Carbohydrate - Total 1.4g
Sugars 0.81g
Sodium 3.36mg
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return To Shop

Add Order Note Edit Order Note
Estimate Shipping

Estimate Shipping

[Clearance Sale] Dr Lancy Noni Juice 30ml x 30 pack

$98.00 $15.00