Antipodes Joyous Protein Rich Night Replenish Serum 30ml

Excl. GST


Shipping calculated at checkout.
SKU: 1840-ANT100N/A
Out of stock
Parcels normally take 1-3 days to arrive within New Zealand or 3-14 days to arrive in other destinations, depending on where you are located. hoursminutes

american expressjcbapple paymasterpaypalvisaalipaywechatpay

Rescue dry, damaged skin with this silky night serum. Himalayan goji berry boasts up to 19 amino acids to help optimise your skin’s appearance. Red raspberry seed oil blends with New Zealand blackcurrant, a rich source of essential fats like gamma-linolenic acid (GLA). South Pacific hibiscus flower freshens your complexion, while berry fragrance imparts pure joy.

Key Ingredients;

  • Goji berry
  • Hibiscus flower
  • Raspberry seed oil

Pure Plant Fragrance: Wild blackcurrant

Directions: Apply at night to your face, neck and décolletage before your favourite Antipodes moisturiser. Suited to normal, dry and mature skin conditions.

e30ml / 1.0fl oz

Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return To Shop

Add Order Note Edit Order Note
Estimate Shipping

Estimate Shipping

Antipodes Joyous Protein Rich Night Replenish Serum 30ml
