Sold out

Wild Ferns Lanolin Gift Box

Excl. GST

$34.70 $26.02

Tax included. Shipping calculated at checkout.

Notify me when this product is available:

american expressjcbapple paymasterpaypalvisaalipaywechatpay

Lanolin Gift Box contains;

  • Lanolin Moisturising Facial Lotion with Green Tea and Manuka Honey
  • Lanolin Soap
  • Lanolin Lip Balm with Shea Butter
  • Lanolin Hand & Nail Creme with Rosehip Oil and Keratin

Lanolin Moisturising Facial Lotion with Green Tea and Manuka Honey 100ml
Help nourish and enrich your skin with hydrating and nourishing Lanolin combined with Manuka Honey - renowned for its restorative and healing effects. Green Tea, rich in antioxidants, works to shield the skin against everyday environmental damage. This is a moisturiser that calms the skin and gently restores a more youthful glow. With the difference between a face lotion and a crème being its oil to water ratio, a lotion has less oil so is much lighter on the skin. It absorbs quickly and leaves very little residue. This is a fantastic option during the warmer more humid months or when your skin type has changed due to the climate.

Key Ingredients: Collagen, Evening Primrose Oil, Ginger Root Extract, Sage Leaf Extract, Sesame Seed Oil, Borage Seed Oil, Meadowfoam Seed Oil

Directions: After cleansing, apply a small amount of lotion and gently smooth in an upward direction onto the face and neck. May be used morning or night.

Lanolin Pure and Delicate Soap 135g
A gentle triple milled soap that lathers you skin with softening moisture, leaving it clean, smooth and delicately fragranced.

Directions: Lather from top to toe and rinse. May be used on hands or body. Not recommended for use on the face.

Lanolin Lip Balm with Shea Butter 15g
This Lip Balm naturally nourishes the skin with Lanolin, Shea Butter and Beeswax. These ingredients also provide powerful moisturising, healing and protecting properties to hydrate and condition the lips. Shea Butter naturally contains Vitamins A & E which helps to soothe and moisturise dry and chapped lips. Blended with Sweet Almond Oil, Cocoa Butter, Vitamin E and Hazel Seed Oil further assist in protecting your lips from the elements. This lip balm is lovely used at night to moisturise and heal your lips while you sleep, and fantastic during the colder months; or when exposed to cool dry air or air conditioning for long periods of time. All Wild Ferns lip products contain natural Bees Wax which is exceptionally hydrating.

Key Ingredients: Aloe Vera Leaf Juice, Marshmallow Root Extract

Directions: Apply to your lips as needed.

Lanolin Hand & Nail Creme with Rosehip Oil and Keratin 85ml
This intensive hand and nail crème contains the exceptional moisturising and conditioning properties of Lanolin, combined with Keratin and Rosehip oil. Keratin improves the structure and strength of the nail and cuticle area and also assists in the elasticity of the skin. The Vitamin A & C in Rosehip Oil enhances skin cell rejuvenation to create a visible improvement to your hands' appearance. Combined with four beautiful oils; Sweet Almond, Tea Seed, Kiwi Seed and Grape Seed Oil - all chosen to fill the skin with moisture, nourishment and antioxidants.

Key Ingredients: Aloe Vera, Shea Butter, Papaya Fruit Extract, Echinacea Extract, Green Tea Extract, Vitamin E

Directions: Apply as often as required on and around nails, cuticles and hands. Perfect for during the day.

Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return To Shop

Add Order Note Edit Order Note
Estimate Shipping

Estimate Shipping