Trilogy Replenishing Night Cream 60g

Excl. GST


Tax included. Shipping calculated at checkout.
SKU: 1871-02022226N/A
Out of stock
Parcels normally take 1-3 days to arrive within New Zealand or 3-14 days to arrive in other destinations, depending on where you are located. hoursminutes

american expressjcbapple paymasterpaypalvisaalipaywechatpay

Trilogy's certified natural Age-Proof Replenishing Night Cream rejuvenates complexions with intensely nourishing natural actives that help diminish the appearance of fine lines and wrinkles.

This advanced natural formulation includes plant-derived hyaluronic acid to plump skin and smooth lines, nourishing marula and olive oils to deliver essential fatty acids (omega 3 and 6) for healthy skin function, antioxidant rich co-enzyme Q10 helps fight free radical damage, and Trilogy's trademarked glycation fighting Glycablend™ complex for a more supple and youthful appearance.

Suitable for all skin types, particularly those showing signs of ageing such as dry/dehydrated skin.

Key Benefits;

  • Intensely nourishing and rejuvenating
  • Helps diminish the appearance of fine lines and wrinkles
  • Helps restore elasticity and suppleness overnight


Apply to cleansed skin on face, neck and décolletage each night before bed.

Key Ingredients;

  • Glycablend™: Trilogy’s anti-aging botanical complex with chia, blueberry and strawberry seed oils which helps to improve skin texture, reduces the appearance of fine lines and wrinkles and restores radiance.
  • Plant-Derived Hyaluronic Acid: A hydrating wonder ingredient for a plumping and smoothing moisture boost.
  • Co-Enzyme Q10:A powerful antioxidant that strengthens and revitalizes the skin while helping to provide resilience against environmental stressors.
  • Marula Oil: Rich in sterols, antioxidants and essential fatty acids to nourish and smooth.

Ingredients: Aqua (Water), Coco-Caprylate, Prunus Amygdalus Dulcis (Sweet Almond) Oil, Cetearyl Alcohol, Cetearyl Olivate (and) Sorbitan Olivate, Caprylic/Capric Triglyceride, Salvia Hispanica (Chia) Seed Oil, Theobroma Cacao (Cocoa) Seed Butter, Vaccinium Angustifolia (Blueberry) Seed Oil, Fragaria Vesca (Strawberry) Seed Oil, Punica Granatum (Pomegranate) Seed Oil, Co-Enzyme Q10 (Ubiquinone), Glycyrrhiza Glabra (Licorice) Root Extract, Morus Alba (Mulberry) Root Extract, Cucumis Sativus (Cucumber) Fruit Extract, Chamomilla Recutita Matricaria (chamomile) Flower Extract, Oenothera Biennis (Evening Primrose) Seed Oil, Sodium Hyaluronate (Hyaluronic Acid), Tocopheryl Acetate (vitamin E), Sclerocarya Birrea (Marula) Seed Oil, Olea Europaea (Olive) Fruit Oil, Persea Gratissima (Avocado) Oil, Aloe Barbadensis (Aloe Vera) Leaf Juice, Calendula Officinalis (Marigold) Flower Extract (and) Glycine Soja (Soybean) Oil, Camellia Sinensis (Green Tea) Leaf Extract, Sodium Stearoyl Glutamate, Citric Acid, Sodium Hydroxide, Dehydroacetic Acid (and) Benzyl Alcohol, Parfum, Benzyl Alcohol, Citronellol, Limonene, Eugenol, Farnesol, Geraniol, Linalool, Dehydroacetic Acid (and) Benzyl Alcohol

Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return To Shop

Add Order Note Edit Order Note
Estimate Shipping

Estimate Shipping

Trilogy Replenishing Night Cream 60g
