Aotea WellnessAotea WellnessAotea Wellness

Wild Ferns Manuka Honey Ultra Enriching Night Creme Dry to Normal (100g)

Excl. GST

$26.00

Tax included. Shipping calculated at checkout.
SKU: 169-MNNCDN/A
Out of stock
Parcels normally take 1-3 business days to arrive within New Zealand or 7-14 business days to arrive in other destinations, depending on where you are located.

*During the holiday seasons, we kindly ask for your understanding as shipping and fulfillment times may be extended.* hoursminutes

american expressjcbapple paymasterpaypalvisaalipaywechatpay

Wild Ferns - Manuka Honey Ultra Enriching Night Creme Dry to Normal 100g

A skin recharging night creme formulated with premium certified Manuka Honey 80+ with carefully selected ingredients that nourish and replenish the skin while you sleep. Powerful antioxidant Co Enzyme Q10 combines with moisturising Apricot Kernel and Jojoba Oils, while Vitamin A and Buttermilk help promote cell renewal. Thirsty skin types are immediately quenched and a softer, more radiant complexion is revealed every morning.

Other beneficial ingredients;

  • Sweet Almond Oil
  • Vitamin E
  • Birch Bark Extract

Directions: Gently smooth in an upward direction on the face and neck avoiding the eye area.Use Nightly.

Complementary Products

  • Refreshing Facial Wash
  • Conditioning Face Mask
  • Repair Eye Serum
  • Protecting Hydrating Moisturiser SPF30

98.4% Natural

  • Paraben Free
  • No Mineral Oil
  • No tested on Animals

Made in New Zealand
100g/3.52oz

Sunday,Monday,Tuesday,Wednesday,Thursday,Friday,Saturday
January,February,March,April,May,June,July,August,September,October,November,December
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return To Shop

Add Order Note Edit Order Note
Estimate Shipping

Estimate Shipping

Wild Ferns Manuka Honey Ultra Enriching Night Creme Dry to Normal (100g)

$26.00