O2B Co-Q10 High Strength 150mg 100 capsules

Excl. GST

$86.87

Tax included. Shipping calculated at checkout.
SKU: 1764-O2B320N/A
Out of stock
Parcels normally take 1-3 days to arrive within New Zealand or 3-14 days to arrive in other destinations, depending on where you are located. hoursminutes

american expressjcbapple paymasterpaypalvisaalipaywechatpay

O2B Healthy CoQ10 (Co-Enzyme Q10) is a high strength dose of this vitamin-like, antioxidant, fat soluble compound. CoQ10, also known as Ubiquinone as it is ubiquitous to the body having an indispensable role in intracellular energy production of ATP, the body's main energy molecule in aerobic respiration.

Co-Q10 helps protect the body from oxidative stress caused by free radicals and is key in fatty acid utilisation. Common signs and symptoms of Co-Q10 deficiency include muscle pain, fatigue, hypertension, hyperthyroidism, pancreatic insufficiency, depression, ischaemic heart disease, cardiomyopathy and congestive heart failure. The mechanism of statin drug action adversely affects the synthesis of Co-Q10 and many adverse side effects of these drugs are directly linked to low levels of Co-Q10, therefore nutritionally minded physicians recommended supplementation for those taking statins.

Support for:

  • Statin drug use
  • Premature ageing
  • High blood pressure
  • Cholesterol regulation
  • Cardiovascular health
  • Fatigue and poor endurance
  • Post cardiac surgery recovery
  • Chronic Fatigue Syndrome
  • Depression
  • Tinnitus & hearing loss
  • Pre-Diabetes and Diabetes
  • Hyperthyroidism
  • Muscle pain & fibromyalgia
Key Benefits:
  • Powerful antioxidant
  • Helps recycle Vitamin E
  • Supports healthy blood pressure
  • Cardio-protective
  • Neuro-protective
  • Helps to prevent migraines
  • Improves endurance and stamina
  • Increases cellular energy production
  • Helps to funds pancreas function
  • Slow progression of muscle dysfunction

O2B Co-Q10 improves cellular energy production by supporting the manufacture of ATP, the body's main energy molecule that is needed by all cells for optimal functioning. After 30 years of age, most people’s Co-Q10 levels begin to diminish and supplementation is advised to help protect delicate DNA from free radical damage. Co-Q10 is found throughout the body, but is particularly needed by the cells of smooth muscle, the brain, thyroid, heart, liver, kidney, and pancreas to fund their function.

Directions: Adults take: 1-2 capsules daily or as directed by your health care professional.

Ingredients:
Each capsule contains: 
  • Co enzyme Q10 150mg (Ubiquinone)

  • May contain encapsulating aids

Free From:

Yeast, corn, wheat, artificial flavours or preservatives.

Cautions:

If taking prescription medication, pregnant, nursing or have known sensitivities please consult your health care professional before taking this product.

Warning:

If  taking blood pressure medication please consult with your health care professional before taking this product.

Sunday,Monday,Tuesday,Wednesday,Thursday,Friday,Saturday
January,February,March,April,May,June,July,August,September,October,November,December
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return To Shop

Add Order Note Edit Order Note
Estimate Shipping

Estimate Shipping

O2B Co-Q10 High Strength 150mg 100 capsules

$86.87