O2B Vitamin B Complex - 100 capsules

Excl. GST

$77.30

Tax included. Shipping calculated at checkout.
SKU: 1764-O2B143N/A
Out of stock
Parcels normally take 1-3 days to arrive within New Zealand or 3-14 days to arrive in other destinations, depending on where you are located. hoursminutes

american expressjcbapple paymasterpaypalvisaalipaywechatpay

O2B Vitamin B complex taken regularly can help provide the body with extra energy, metabolism of fats and protein, for the normal functioning of the nervous system, maintenance of the gastrointestinal tract, and the health of the skin, hair, eyes, mouth and liver. 

Key Benefits:

  • Enhances and maintains healthy metabolism
  • Increases energy levels
  • Promotes healthy skin, hair and nails
  • Supports the body’s response to stress
  • Actively supports Mental Health
  • Facilitates relaxation

Directions: Take 1 capsule daily or as directed by your health care professional.

Each capsule contains: 

Thiamine HCL (equiv to 100mg Vit B1)  112mg
Vitamin B2 (Riboflavin)  100mg
Vitamin B3 (Niacinamide)  100mg
Vitamin B5 (Calcium Pantothenate)  109mg
Vitamin B6 (Pyridoxine HCL)  121mg
Choline bitartrate  65mg
Inositol  65mg
PABA (Para-aminobenzoic acid)  10mg
Folic acid  300mcg
Biotin  100mcg
Vitamin B12 (Cyanocobalamin)  50mcg
Encapsulating aids  


Free from: Yeast, corn, wheat, gluten, artificial flavors or preservatives.

CAUTION: If taking prescription medication, pregnant, nursing or you have known ingredient sensitivities please consult your health care professional before taking this product. 

WARNING: 

  • Do not take if on Warfarin, Coumadin or blood thinners.
  • Do not take if you have a kidney problem.

Made in New Zealand

Sunday,Monday,Tuesday,Wednesday,Thursday,Friday,Saturday
January,February,March,April,May,June,July,August,September,October,November,December
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return To Shop

Add Order Note Edit Order Note
Estimate Shipping

Estimate Shipping

O2B Vitamin B Complex - 100 capsules

$77.30