NZFOS+ Prebiotic Yacon Concentrate 80°Brix 250g Gift Set

Excl. GST

$738.26

Tax included. Shipping calculated at checkout.
SKU: 1864-Y2UB250N/A
Out of stock
Parcels normally take 1-3 days to arrive within New Zealand or 3-14 days to arrive in other destinations, depending on where you are located. hoursminutes

american expressjcbapple paymasterpaypalvisaalipaywechatpay

Yacon Concentrate has the consistency of golden syrup, or a thick honey, and a rich, sweet resinous taste that can remind the taster of raisins.

The sugar in yacon is mainly fructooligosaccharides (FOS) prebiotics that pass through the digestive system without being metabolised, as the human system doesn’t have an enzyme to hydrolyse FOS. Therefore, it is tastes sweet, but with a GI score of only 40.

YACON contains natural prebiotic materials, supporting the growth and health of the microflora in our bodies. When our probiotic bacteria are well-taken care of and healthy, our body can maximise its intake of vitamins and minerals. By optimising the absorption levels of our food, we are able to get more “bang for our buck”, so to speak, when we eat any other foods.

Directions

Take directly with a wooden spoon 1-2 times a day. Ideal for sweetening all raw natural recipes. FOS prebiotics works best consumed 20 – 30 minutes before lunch or dinner. Recommended daily intake: 12 to 30 grams. Drink plenty of water during the day for it contains water soluble fibre.

To protect the prebiotic properties, do not heat over 50°C.

Servings per pack: 42

Note: this score shows the contribution which 100g food makes to the reference values for FOS.

Sunday,Monday,Tuesday,Wednesday,Thursday,Friday,Saturday
January,February,March,April,May,June,July,August,September,October,November,December
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return To Shop

Add Order Note Edit Order Note
Estimate Shipping

Estimate Shipping

NZFOS+ Prebiotic Yacon Concentrate 80°Brix 250g Gift Set

$738.26