Go Healthy Go Multi Everyday-30 Vege Capsules

Excl. GST

$29.48

Tax included. Shipping calculated at checkout.
SKU: 1825-GO1653N/A
Out of stock
Parcels normally take 1-3 days to arrive within New Zealand or 3-14 days to arrive in other destinations, depending on where you are located. hoursminutes

american expressjcbapple paymasterpaypalvisaalipaywechatpay

GO MULTI EVERYDAY is a high potency, all in one multi-vitamin and mineral supplement designed for both men and women. GO Multi Everyday works to support energy levels and maintain general health and well-being. Taking a high quality multi vitamin and mineral supplement is recommended by Healthcare Professionals worldwide.

  • Convenient 1-A-Day dose
  • For use when dietary intake is inadequate
  • Supports health and energy
  • Supports mental clarity and mood
  • Supports normal metabolism
  • Folic Acid 300mcg per capsule
  • VegeCap Advantage
INGREDIENTS
Vitamin B1 - Thiamin 77mg, Vitamin B2 - Riboflavin 77mg, Vitamin B3 - Niacin 77mg, Vitamin B5 - Pantothenic Acid 112mg, Vitamin B6 77mg, Biotin 50mcg, Folic Acid 300mcg, Vitamin B12 - Cyanocobalamin 50mcg, Choline 25mcg, Inositol 25mg, Vitamin E 50IU, Vitamin C 150mg, Vitamin D3 2.5IU, Beta-carotene 5mg, Iron 10mg, Calcium equiv. to 25mg, Zinc equiv. to 5mg, Magnesium amino acid chelate 5mg, Manganese equiv. to 2mg, Chromium Picolinate 400mcg, Selenium 50mcg, Iodine 150mcg, Citrus Bioflavonoids 25mg, Panax Ginseng equiv. to dry root 150mg, Kelp equiv. to dry 6mg
SUGGESTED DOSE

Adults: Take 1 VegeCap daily. Can be taken anytime, with food or on an empty stomach. Or as directed by your Healthcare Professional.

SAFETY INFORMATION

Not to be taken during pregnancy or lactation.

Always read the label. Take only as directed.

MEDICINE INTERACTIONS: If taking prescription medication or if in doubt, please consult your Healthcare Professional.

Made by GO Healthy in New Zealand from select imported ingredients.
Sunday,Monday,Tuesday,Wednesday,Thursday,Friday,Saturday
January,February,March,April,May,June,July,August,September,October,November,December
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return To Shop

Add Order Note Edit Order Note
Estimate Shipping

Estimate Shipping

Go Healthy Go Multi Everyday-30 Vege Capsules

$29.48