Aotea WellnessAotea WellnessAotea Wellness

Alpine Silk Hydra Plus Replenishing Placenta Moisture Creme 100g

Excl. GST

$29.48

Shipping calculated at checkout.
SKU: 77-AG02N/A

Size: Single

  • Single
Out of stock
*Due to increased holiday demand, we kindly ask for your understanding as shipping and fulfillment times may be extended.*
Parcels normally take 1-3 business days to arrive within New Zealand or 7-14 business days to arrive in other destinations, depending on where you are located. hoursminutes

american expressjcbapple paymasterpaypalvisaalipaywechatpay

This silky smooth revitalising placenta creme is easily absorbed into the skin, leaving it soft and beautiful, with no greasy residue. Alpine Silk's Hydra Plus Replenishing creme contains placenta, amino acids and proteins, help the elasticity of the epidermis and assists to revitalise and protect your skin.

Made in New Zealand

Key Benefits¶ÿ

  • Lanolin is an excellent natural moisturiser, relieving dry skin and enhancing skin hydration by forming a protective, soothing barrier against the elements.
  • The Placenta used in our products is plant based. Placenta is one of the great building blocks of life and when put into creme can assist in new cell regeneration.
  • Vitamin E is a powerful antioxidant which helps protect the health of skin cells from the harmful effects of Ultraviolet light, toxins, pollution and environmental stress.
  • Aloe Vera extracts have effective soothing, healing and hydrating properties. Quickly absorbed, Aloe Vera soothes and moisturises, helping to keep your skin smooth, soft and supple.
  • "Ingredients: Water, Cetyl Alcohol, Octyl Methoxycinnamate Isodecyl Oleate, Glycerin Benzophenone - 3, Acetylated Lanolin Alcohols, Mineral Oil, Stearic Acid, Placenta Extract, Butyl Methoxy-dibenzoylmethane, Titanium Dioxide, Isopropyl Myristate, Triethanolamine, Phenoxyethanol, Tocopheryl Acetate, Methyl Paraben, Ethyl Paraben, Propyl Paraben, Butyl Paraben.

    Directions

    Smooth a small amount of crÇùme evenly over face and neck until absorbed.

    Sunday,Monday,Tuesday,Wednesday,Thursday,Friday,Saturday
    January,February,March,April,May,June,July,August,September,October,November,December
    Not enough items available. Only [max] left.
    Add to WishlistBrowse WishlistRemove Wishlist
    Shopping cart

    Your cart is empty.

    Return To Shop

    Add Order Note Edit Order Note
    Estimate Shipping

    Estimate Shipping

    Alpine Silk Hydra Plus Replenishing Placenta Moisture Creme 100g

    $29.48