website

Manuka South Premium Royal Jelly 1000mg 365 capsules

Excl. GST

$54.70

Shipping calculated at checkout.
SKU: 1820-MSRJ365N/A
Out of stock
Parcels normally take 1-3 days to arrive within New Zealand or 3-14 days to arrive in other destinations, depending on where you are located. hoursminutes

american expressjcbapple paymasterpaypalvisaalipaywechatpay

Manuka South Royal Jelly 1,000mg 0.3% 10-HDA is our most popular royal jelly product. It comes in softgel form and is easy to dissolve and digest. As an everyday health tonic, Manuka South Royal Jelly is perfect for older children all the way up to elderly adults.  Royal jelly is packed full of trace amounts of almost all essential vitamins and minerals, as well as protein, fatty acids, and sugars. It is regarded as a highly nutrition substance and used to help enhance overall health and vitality.

365 capsules
Made in New Zealand

Facts & Benefits

Premium Royal Jelly is fed in high amounts to the queen bee in a hive, which allows it to become significantly bigger than the rest of the bees in the hive. This increased nutrition also allows the queen bee to have enhanced ovarian function and produce multiple offspring. Because of its ability to enhance and grow the queen bee so much bigger than the rest of the hive, royal jelly has long been believed by humans to be a form of a super food that may also help to enhance and improve overall nutrition and human health. Many people supplement with our Manuka South Premium Royal Jelly daily as a way to boost nutritional intake and fill in any dietary gaps of nutrients. Because premium royal jelly is an all-natural and non-synthetic substance, it is well tolerated and absorbed by the body.

Ingredients: Royal Jelly Powder, Vegetable Oil, Lecithin, D-alpha Tocopherol, Beeswax - White, Coconut Oil, Soy Oil Encapsulating materials; Gelatin, Glycerol, Sorbitol. Water. Directions: Take two capsules daily with or without food. Store in a cool dry place below 25°C out of direct sunlight. Warning: Royal jelly can cause severe allergic reactions in certain people. This product is not recommended for asthma or allergy sufferers.
Sunday,Monday,Tuesday,Wednesday,Thursday,Friday,Saturday
January,February,March,April,May,June,July,August,September,October,November,December
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return To Shop

Add Order Note Edit Order Note
Estimate Shipping

Estimate Shipping

Manuka South Premium Royal Jelly 1000mg 365 capsules

$54.70