Aotea WellnessAotea WellnessAotea Wellness

Cervidor Deer Pizzle and Testicle 1,100mg 60 Capsules

Excl. GST

$78.17

Shipping calculated at checkout.
SKU: 1865-CDP1100N/A
Out of stock
*Due to increased holiday demand, we kindly ask for your understanding as shipping and fulfillment times may be extended.*
Parcels normally take 1-3 business days to arrive within New Zealand or 7-14 business days to arrive in other destinations, depending on where you are located. hoursminutes

american expressjcbapple paymasterpaypalvisaalipaywechatpay

Cervidor is an expert and a global reference standard for deer products. We harness the strength and efficacy of free-range New Zealand Red Deer through a vertically integrated supply chain from the farm to finished product. 100% natural and pure active ingredients guaranteed.

Grown and Made in New Zealand

60 x 1100mg Capsules

How it works: Cervidor Deer Pizzle and Testicle is rich in protein, minerals, hormones and cartilage. Oriental medical beliefs consider Deer Pizzle and Testicle beneficial in:

  • improving the function of the kidneys
  • stimulating male sexual drive
  • improving overall vigour.

    Ingredients: Each capsule includes 200mg of Deer Pizzle and Testicle Powder, equivalent to 1100mg of fresh Deer Pizzle and Testicle. No other ingredients, additives, fillers or excipients.

    Dosage: Adults-take 1-2 capsules daily or as professionally directed. Always check with your doctor first if you are taking prescribed medicine.

    Storage: Store in a cool dry place away from direct sunshine. Do not use if cap seal is missing or broken.

    Always check with your doctor first if you are taking prescribed medicine.

    Sunday,Monday,Tuesday,Wednesday,Thursday,Friday,Saturday
    January,February,March,April,May,June,July,August,September,October,November,December
    Not enough items available. Only [max] left.
    Add to WishlistBrowse WishlistRemove Wishlist
    Shopping cart

    Your cart is empty.

    Return To Shop

    Add Order Note Edit Order Note
    Estimate Shipping

    Estimate Shipping

    Cervidor Deer Pizzle and Testicle 1,100mg 60 Capsules

    $78.17