Nature's Beauty Ovine Placenta Crème (50g)

Excl. GST

$24.26

Shipping calculated at checkout.
SKU: 113-OP61N/A
Out of stock
Parcels normally take 1-3 days to arrive within New Zealand or 3-14 days to arrive in other destinations, depending on where you are located. hoursminutes

american expressjcbapple paymasterpaypalvisaalipaywechatpay

The ultimate anti-wrinkle day creme ideal for rejuvenating tired and unhealthy skin cells on the face and neck. Enriched with Placenta, Aloe Vera, Bee Propolis, Lanolin, Vitamins B5, C, E and sunscreen to protect the new skin.

Use daily to nourish, protect and help restore texture and youthfulness to the skin. This non-greasy creme is easily absorbed into the skin.

50g
Made in New Zealand

Ingredients: Aqua (Water), Capric/Caprylic Triglyceride, Glycerine, Glyceryl Stearate, Cetyl Alcohol, Cetearyl Alcohol & PEG-20 Stearate, Stearic Acid, Octyl Palmitate, PPG-15 Stearyl Ether, Octyl Methoxycinnamate, Placental Protein, Lanolin Alcohol, Simmondsia Chinensis (Jojoba) Oil, Aloe Barbadensis (Aloe Vera) Extract, Triethanolamine, Dimethicone, Ceteareth-20, Phenoxyethanol, Sodium Ascorbyl Phospate, Pro-Vitamin B5, Acetylated Lanolin Alcohol, Tocopheryl Acetate (Vitamin E), Methylchloroisothiazolinone, Methylisothiazolinone, Propolis Extract, Ascorbic Acid (Vitamin C), Diazolidinyl Urea, Fragrance.

This product cannot be sold, resold or distributed into the USA for trademark reasons.

Sunday,Monday,Tuesday,Wednesday,Thursday,Friday,Saturday
January,February,March,April,May,June,July,August,September,October,November,December
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return To Shop

Add Order Note Edit Order Note
Estimate Shipping

Estimate Shipping

Nature's Beauty Ovine Placenta Crème (50g)

$24.26